{"product_id":"proteintech-66517-1-ig","title":"Proteintech, 66517-1-Ig, Caspase 2\/P32\/P18 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Caspase 2\/P32\/P18 (66517-1-Ig) by Proteintech is a Monoclonal antibody targeting Caspase 2\/P32\/P18 in WB, ELISA applications with reactivity to human samples\n66517-1-Ig targets Caspase 2\/P32\/P18 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCASP2(Caspase-2) is also named as ICH1, NEDD2 and belongs to the peptidase C14A family.It  is involved in the activation cascade of caspases responsible for apoptosis execution and might function by either activating some proteins required for cell death or inactivating proteins necessary for cell survival.It has 2 isoforms produced by alternative splicing and can exists almost as a dimer in solution(PMID:15865942).This antibody can recognize the 32 kDa pro-caspase 2  as well as 18 kDa cleaved-caspase 2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag20141 Product name: Recombinant human Caspase 2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 170-325 aa of BC002427 Sequence: GPLCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDET Predict reactive species\nFull Name: caspase 2, apoptosis-related cysteine peptidase\nCalculated Molecular Weight: 452 aa, 51 kDa\nObserved Molecular Weight: 48-51 kDa, 32 kDa, 18 kDa\nGenBank Accession Number: BC002427\nGene Symbol: Caspase 2\nGene ID (NCBI): 835\nRRID: AB_2881880\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P42575\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888104853673,"sku":"66517-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66517-1-ig","provider":"Iright","version":"1.0","type":"link"}