{"product_id":"proteintech-66521-1-ig","title":"Proteintech, 66521-1-Ig, Recoverin Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Recoverin (66521-1-Ig) by Proteintech is a Monoclonal antibody targeting Recoverin in WB, ELISA applications with reactivity to Human, rat, pig, mouse samples\n66521-1-Ig targets Recoverin in WB, ELISA applications and shows reactivity with Human, rat, pig, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig retina tissue, rat retina tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2500-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRecoverin, belonging to a family of the neuronal calcium sensor (NCS) proteins, has a restricted expression in retinal photoreceptors or neurons or neuroendocrine cells. It has been suggested to play a role in light and dark adaptation by regulating rhodopsin phosphorylation. Recently, it has been found that autoantibodies against recoverin (24 kDa) have been strongly associated with cancer -associated retinopathy (CAR) syndrome, a paraneoplastic disease of the retina. But functions of recoverin in cancer cells remain unknown.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, rat, pig, mouse\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag0119 Product name: Recombinant human Recoverin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 7-166 aa of BC001720 Sequence: GALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDK Predict reactive species\nFull Name: recoverin\nCalculated Molecular Weight: 24 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC001720\nGene Symbol: Recoverin\nGene ID (NCBI): 5957\nRRID: AB_2881884\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P35243\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888073822377,"sku":"66521-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66521-1-ig","provider":"Iright","version":"1.0","type":"link"}