{"product_id":"proteintech-66527-1-ig","title":"Proteintech, 66527-1-Ig, MFF Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe MFF (66527-1-Ig) by Proteintech is a Monoclonal antibody targeting MFF in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples\n66527-1-Ig targets MFF in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig brain tissue, L02 cells,  HepG2 cells,  rat brain tissue,  mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMFF (mitochondrial fission factor) is a mitochondrial outer membrane protein that is involved in mitochondrial localization of Drp1 and mitochondrial fission. Multiple isoforms of MFF exist due to the alternative splicing. This antibody recognizes the endogenous MFF protein around 26-29 kDa and 35-38 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag9990 Product name: Recombinant human MFF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-238 aa of BC000797 Sequence: MAEISRIQYEMEYTEGISQRMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQSTPFKPLALKTPPRVLTLSERPLDFLDLERPPTTPQNEEIRAVGRLKRERSMSENAVRQNGQLVRNDSLPVLRGGSAAATSNPHHDNVRYGISNIDTTIEGTSDDLTVVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLWFRR Predict reactive species\nFull Name: mitochondrial fission factor\nCalculated Molecular Weight: 38 kDa\nObserved Molecular Weight: 35-38 kDa\nGenBank Accession Number: BC000797\nGene Symbol: MFF\nGene ID (NCBI): 56947\nRRID: AB_2881890\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9GZY8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888000946345,"sku":"66527-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66527-1-ig","provider":"Iright","version":"1.0","type":"link"}