{"product_id":"proteintech-66532-1-ig","title":"Proteintech, 66532-1-Ig, ACOT9 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ACOT9 (66532-1-Ig) by Proteintech is a Monoclonal antibody targeting ACOT9 in WB, IHC, ELISA applications with reactivity to Human, Rat, mouse samples\n66532-1-Ig targets ACOT9 in WB, IHC, ELISA applications and shows reactivity with Human, Rat, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, RAW 264.7 cells,  Jurkat cells,  HSC-T6 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:20000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nACOT9 (Acyl-coenzyme A thioesterase 9) is a member of the acyl-CoA thioesterase superfamily, which is a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. ACOT9 has 4 isoforms with the molecular mass of 43-50 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Rat, mouse\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag8884 Product name: Recombinant human ACOT9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-212 aa of BC012573 Sequence: MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEVRDKLREIVGASTNWRDHVKAMEERKLLHSFLAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLICYMHNKIHSAKMSPLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDATFVMVARDSENKG Predict reactive species\nFull Name: acyl-CoA thioesterase 9\nCalculated Molecular Weight: 24 kDa, 49 kDa\nObserved Molecular Weight: 43-50 kDa\nGenBank Accession Number: BC012573\nGene Symbol: ACOT9\nGene ID (NCBI): 23597\nRRID: AB_2881895\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9Y305\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888052195497,"sku":"66532-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66532-1-ig","provider":"Iright","version":"1.0","type":"link"}