{"product_id":"proteintech-66540-1-ig","title":"Proteintech, 66540-1-Ig, Calponin 1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Calponin 1 (66540-1-Ig) by Proteintech is a Monoclonal antibody targeting Calponin 1 in WB, IHC, ELISA applications with reactivity to human samples\n66540-1-Ig targets Calponin 1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human heart tissue, human vein tissue,  human colon tissue,  human ileum tissue,  human bladder tissue,  human kidney tissue\nPositive IHC detected in: human myofibroblastoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1500-1:6000\nImmunohistochemistry (IHC): IHC : 1:150-1:600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCalponin is a family of actin filament-associated proteins which regulate smooth muscle cell contraction. Three isoforms of calponin exist: calponin h1 (CNN1) , calponin h2 (CNN2) and calponin 3 (CNN3). CNN1 is a basic 34-kD protein specifically expressed in smooth muscle and a marker of smooth muscle cell differentiation. This antibody raised against the specific region of human CNN1, thus it does not cross-react with CNN2 or CNN3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse, rat\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag21384 Product name: Recombinant human Calponin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 225-265 aa of BC022015 Sequence: KRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPR Predict reactive species\nFull Name: calponin 1, basic, smooth muscle\nCalculated Molecular Weight: 33 kDa\nObserved Molecular Weight: 33-35 kDa\nGenBank Accession Number: BC022015\nGene Symbol: Calponin\nGene ID (NCBI): 1264\nRRID: AB_2881902\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P51911\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888037679273,"sku":"66540-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66540-1-ig","provider":"Iright","version":"1.0","type":"link"}