{"product_id":"proteintech-66552-1-ig","title":"Proteintech, 66552-1-Ig, XLF Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe XLF (66552-1-Ig) by Proteintech is a Monoclonal antibody targeting XLF in WB, IHC, ELISA applications with reactivity to Human samples\n66552-1-Ig targets XLF in WB, IHC, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  MCF-7 cells,  Jurkat cells\nPositive IHC detected in: human testis tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-30000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nXRCC4-like factor (XLF), also known as Cernunnos and NHEJ1, is a protein encoded by the human NHEJ1 gene and an important repair factor for DNA double-strand breaks. NHEJ is a well-known mechanism for the repair of double-strand breaks (DSBs), a lethal type of DNA damage in mammalian cells. It basically utilizes a group of enzymes to take hold of the ends of a broken DNA molecule, create a bridge between them, and subsequently re-ligate the broken DNA molecule.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag2496 Product name: Recombinant human NHEJ1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-299 aa of BC030986 Sequence: MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQEVQVGQKHQGAGDPHTSNSASLQGIDSQCVNQPEQLVSSAPTLSAPEKESTGTSGPLQRPQLSKVKRKKPRGLFS Predict reactive species\nFull Name: nonhomologous end-joining factor 1\nCalculated Molecular Weight: 35 kDa\nObserved Molecular Weight: 37 kDa\nGenBank Accession Number: BC030986\nGene Symbol: XLF\nGene ID (NCBI): 79840\nRRID: AB_2881914\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9H9Q4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888336851113,"sku":"66552-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66552-1-ig","provider":"Iright","version":"1.0","type":"link"}