{"product_id":"proteintech-66577-1-ig","title":"Proteintech, 66577-1-Ig, SLC9A9 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC9A9 (66577-1-Ig) by Proteintech is a Monoclonal antibody targeting SLC9A9 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, Mouse, Rat samples\n66577-1-Ig targets SLC9A9 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  MCF-7 cells,  HepG2 cells,  HSC-T6 cells,  NIH\/3T3 cells,  RAW 264.7 cells\nPositive IHC detected in: human kidney tissue, human tonsillitis tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag4660 Product name: Recombinant human SLC9A9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 481-645 aa of BC035779 Sequence: TPMLTWLQIRVGVDLDENLKEDPSSQHQEANNLDKNMTKAESARLFRMWYSFDHKYLKPILTHSGPPLTTTLPEWCGPISRLLTSPQAYGEQLKEDDVECIVNQDELAINYQEQASSPCSPPARLGLDQKASPQTPGKENIYEGDLGLGGYELKLEQTLGQSQLN Predict reactive species\nFull Name: solute carrier family 9 (sodium\/hydrogen exchanger), member 9\nCalculated Molecular Weight: 645 aa, 73 kDa\nObserved Molecular Weight: 73 kDa\nGenBank Accession Number: BC035779\nGene Symbol: SLC9A9\nGene ID (NCBI): 285195\nRRID: AB_2881937\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8IVB4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888049737897,"sku":"66577-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66577-1-ig","provider":"Iright","version":"1.0","type":"link"}