{"product_id":"proteintech-66609-1-ig","title":"Proteintech, 66609-1-Ig, MMACHC Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe MMACHC (66609-1-Ig) by Proteintech is a Monoclonal antibody targeting MMACHC in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n66609-1-Ig targets MMACHC in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, K-562 cells,  HEK-293 cells,  HeLa cells,  Raji cells,  RAW 264.7 cells\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMMACHC, also named as CblC, is located on chromosome 1 and comprises four coding exons. Human MMACHC catalyzes the reductive decyanation of cyanocobalamin and may serve as a trafficking chaperone for intracellular cobalamin. It also catalyzes the glutathione-dependent reductive demethylation of methylcobalamin, and, with much lower efficiency, the glutathione-dependent reductive demethylation of adenosylcobalamin. NMACHC binds cyanocobalamin, adenosylcobalamin, methylcobalamin and other, related vitamin B12 derivatives.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag15001 Product name: Recombinant human MMACHC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-225 aa of BC006122 Sequence: MFDRALKPFLQSCHLRMLTDPVDQCVAYHLGRVRESLPELQIEIIADYEVHPNRRPKILAQTAAHVAGAAYYYQRQDVEADPWGNQRISGVCIHPRFGGWFAIRGVVLLPGIEVPDLPPRKPHDCVPTRADRIALLEGFNFHWRDWTYRDAVTPQERYSEEQKAYFSTPPAQRLALLGLAQPSEKPSSPSPDLPFTTPAPKKPGNPSRARSWLSPRVSPPASPGP Predict reactive species\nFull Name: methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria\nCalculated Molecular Weight: 282 aa, 32 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC006122\nGene Symbol: MMACHC\nGene ID (NCBI): 25974\nRRID: AB_2881969\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9Y4U1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888044888233,"sku":"66609-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66609-1-ig","provider":"Iright","version":"1.0","type":"link"}