{"product_id":"proteintech-66623-1-ig","title":"Proteintech, 66623-1-Ig, CHST4 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHST4 (66623-1-Ig) by Proteintech is a Monoclonal antibody targeting CHST4 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n66623-1-Ig targets CHST4 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-29 cells, T-47D cells,  MCF-7 cells,  COLO 320 cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCHST4, also named as HEC GlcNAc6ST and GlcNAc6ST 2, is one of a major GlcNAc-6-O-sulfotransferases involved in synthesizing the L-selectin ligands mediating lymphocyte homing. CHST4 is associated with the expression of MECA-79 epitope on HEV. It has been reported that the transcripts of CHST4 can be detected in lymph node, liver, pancreas and high endothelial venules (HEVs) but at a low level in HUVECs. Besides, CHST4 is expressed at a high level in gastric and colorectal cancer patients compared with normal mucosa. (PMID:30093410, 27748735, 10330415)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag3987 Product name: Recombinant human CHST4 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 177-386 aa of BC035282 Sequence: DPSLNLHIVHLVRDPRAVFRSRERTKGDLMIDSRIVMGQHEQKLKKEDQPYYVMQVICQSQLEIYKTIQSLPKALQERYLLVRYEDLARAPVAQTSRMYEFVGLEFLPHLQTWVHNITRGKGMGDHAFHTNARDALNVSQAWRWSLPYEKVSRLQKACGDAMNLLGYRHVRSEQEQRNLLLDLLSTWTVPEQIH Predict reactive species\nFull Name: carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4\nCalculated Molecular Weight: 370 aa, 43 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: BC035282\nGene Symbol: CHST4\nGene ID (NCBI): 10164\nRRID: AB_2881983\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q8NCG5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888026276009,"sku":"66623-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66623-1-ig","provider":"Iright","version":"1.0","type":"link"}