{"product_id":"proteintech-66626-1-ig","title":"Proteintech, 66626-1-Ig, cIAP1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe cIAP1 (66626-1-Ig) by Proteintech is a Monoclonal antibody targeting cIAP1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples\n66626-1-Ig targets cIAP1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HEK-293 cells,  HepG2 cells,  Hela cells,  Jurkat cells,  HSCT6 cells,  pig brain tissue,  rat brain tissue,  mouse skeletal muscle tissue\nPositive IHC detected in: human spleen tissue, human tonsillitis tissue,  human lung cancer tissue,  human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:150-1:600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBIRC2 (also known as cIAP1) is a member of the inhibitor of apoptosis protein (IAP) family. The inhibitor of apoptosis (IAP) proteins are a family of anti-apoptotic regulators found in viruses and metazoans. BIRC2 is a nuclear shuttling protein, whose subcellular localization is mediated by the CRM1-dependent nuclear export pathway (PMID: 15265700). The protein is regulated transcriptionally and can be inhibited by mitochondrial proteins released in the cytoplasm upon apoptotic stimuli (PMID: 15187025). BIRC2 is also believed to be a critical regulator of vascular integrity and endothelial cell survival, thereby providing an additional target pathway for the control of angiogenesis and blood vessel homeostasis during embryogenesis, regeneration and tumorigenesis (PMID: 17934460).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag21398 Product name: Recombinant human cIAP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 95-196 aa of BC016174 Sequence: LGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPL Predict reactive species\nFull Name: baculoviral IAP repeat-containing 2\nCalculated Molecular Weight: 618 aa, 70 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC016174\nGene Symbol: cIAP1\nGene ID (NCBI): 329\nRRID: AB_2881986\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q13490\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888000323753,"sku":"66626-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66626-1-ig","provider":"Iright","version":"1.0","type":"link"}