{"product_id":"proteintech-66649-1-ig","title":"Proteintech, 66649-1-Ig, CEBPB Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CEBPB (66649-1-Ig) by Proteintech is a Monoclonal antibody targeting CEBPB in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n66649-1-Ig targets CEBPB in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, L02 cells,  HepG2 cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:150-1:600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCAAT\/enhancer-binding protein beta (CEBPB), also known as LAP, is a important transcriptional activator in the regulation of genes involved in immune and inflammatory responses. It specifically binds to an IL-1 response element in the IL-6 gene. NF-IL6 also binds to regulatory regions of several acute-phase and cytokines genes. It probably plays a role in the regulation of acute-phase reaction, inflammation and hemopoiesis. The consensus recognition site is 5'-T[TG]NNGNAA[TG]-3'. Functions in brown adipose tissue (BAT) differentiation By similarity. Regulates the transcriptional induction of peroxisome proliferator-activated receptor gamma (PPARG). CEBPb mRNAs possess alternative translation-initiation codons, which result in the formation of truncated forms of the protein. All major isoforms of CEBPB (38, 34, and 20 kDa) are expressed, with the 34 and 20kDa isoforms being more abundant in preovulatory follicles and further increased in corpora lutea (CL)(PMID:15647458).The truncated protein of 18 kDa (relative to the 30 kDa full-length protein that is known as LAP, or p30 CEBPb or liver-activating protein) lacks a transactivation domain,also known as LIP (p19 CEBPb or liver-inhibitory protein), can form homodimers or heterodimerize with other family members and, as it lacks the transactivation domain, can attenuate the transcriptional activation properties of the other isoforms.(10051447). Three variants of\nCEBPBs have been detected in many cell types: a 46 kDa full-length liver-enriched transcription-activating protein (LAP1), a 42 kDa LAP2 and a 20-kDa liver-enriched transcription-inhibitory protein (LIP). These variants are the result of an alternative translation initiation due to a leaky ribosomal scanning mechanism.(PMID:18820298).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, monkey\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag20073 Product name: Recombinant human CEBPB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-266 aa of BC007538 Sequence: MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKT Predict reactive species\nFull Name: CCAAT\/enhancer binding protein (C\/EBP), beta\nCalculated Molecular Weight: 345 aa, 36 kDa\nObserved Molecular Weight: 40-45 kDa\nGenBank Accession Number: BC007538\nGene Symbol: CEBPB\nGene ID (NCBI): 1051\nRRID: AB_2882006\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P17676\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888002551977,"sku":"66649-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66649-1-ig","provider":"Iright","version":"1.0","type":"link"}