{"product_id":"proteintech-66661-1-ig","title":"Proteintech, 66661-1-Ig, BAG6 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe BAG6 (66661-1-Ig) by Proteintech is a Monoclonal antibody targeting BAG6 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n66661-1-Ig targets BAG6 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HEK-293 cells,  HeLa cells,  HSC-T6 cells,  NIH\/3T3 cells,  RAW 274.7 cells,  PC-12 cells,  Jurkat cells,  HepG2 cells\nPositive IHC detected in: human breast cancer tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBAT3 also known as Scythe or BAG6, is a nuclear protein implicated in the control of apoptosis and natural killer (NK) cell-dendritic cell (DC) interaction. BAT3 was first discovered as a member of a group of genes located within the class III region of the human major histocompatibility complex on chromosome 6, and has been extensively studied for its role in regulating apoptosis under various stress conditions such as DNA damage and endoplasmic reticulum-related stress. BAT3 has been shown to be required for p53 acetylation, which is critical for the enhancement of p53 transcriptional activity in response to DNA damage. In addition, BAT3 is involved in the regulation of development and reproduction of mammals by acting as a co-chaperone of the heat shock protein HSP70.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag24525 Product name: Recombinant human BAG6 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-184 aa of BC003133 Sequence: MEPNDSTSTAVEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTHLPSGASSGTGSASATHGGGSPPGTRGPGASVHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLLSRME Predict reactive species\nFull Name: HLA-B associated transcript 3\nCalculated Molecular Weight: 119 kDa\nObserved Molecular Weight: 150-160 kDa\nGenBank Accession Number: BC003133\nGene Symbol: BAT3\/BAG-6\nGene ID (NCBI): 7917\nRRID: AB_2858188\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P46379\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888056488105,"sku":"66661-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66661-1-ig","provider":"Iright","version":"1.0","type":"link"}