{"product_id":"proteintech-66671-1-ig","title":"Proteintech, 66671-1-Ig, ASF\/SF2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ASF\/SF2 (66671-1-Ig) by Proteintech is a Monoclonal antibody targeting ASF\/SF2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n66671-1-Ig targets ASF\/SF2 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, LNCaP cells,  HEK-293 cells,  HepG2 cells,  Jurkat cells,  HSC-T6 cells,  PC-12 cells,  NIH\/3T3 cells,  RAW 264.7 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human ovary tumor tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSFRS1, also named as ASF, SF2, SF2P33, SFRS1 and ASF-1, belongs to the splicing factor SR family. It plays a role in preventing exon skipping, ensuring the accuracy of splicing and regulating alternative splicing. SFRS1 interacts with other spliceosomal components, via the RS domains, to form a bridge between the 5'- and 3'-splice site binding components, U1 snRNP and U2AF. Isoform ASF-2 and isoform ASF-3 act as splicing repressors. This antibody can recognize all the 3 isoforms(28kd,33kd and 22kd) of SFRS1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag3626 Product name: Recombinant human ASF\/SF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-248 aa of BC010264 Sequence: MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT Predict reactive species\nFull Name: splicing factor, arginine\/serine-rich 1\nCalculated Molecular Weight: 248 aa, 28 kDa\nObserved Molecular Weight: 32 kDa, 28 kDa, 22 kDa\nGenBank Accession Number: BC010264\nGene Symbol: ASF\/SF2\nGene ID (NCBI): 6426\nRRID: AB_2882025\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q07955\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888018411689,"sku":"66671-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66671-1-ig","provider":"Iright","version":"1.0","type":"link"}