{"product_id":"proteintech-66696-1-ig","title":"Proteintech, 66696-1-Ig, ATP5O Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATP5O (66696-1-Ig) by Proteintech is a Monoclonal antibody targeting ATP5O in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n66696-1-Ig targets ATP5O in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  HepG2 cells,  LNCaP cells,  A549 cells,  NCI-H1299 cells,  Jurkat cells,  K-562 cells,  THP-1 cells\nPositive IHC detected in: human liver cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATP5O(ATP synthase subunit O, mitochondrial) is also named as ATPO, OSCP and belongs to the ATPase delta chain family. The gene encodes the oligomycin sensitivity-conferring protein (OSCP) of ATP synthase. The predicted polypeptide is 213 amino acids long with more than 80% identity to the bovine and mouse homologs and it is expressed at highest levels in muscle and heart by the northern blot(PMID:7490082). Many studies have indicated that mitochondrial dysfunction is central to the development of most age-related human diseases including neurodegenerative diseases, cancer, and type 2 diabetes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag1458 Product name: Recombinant human ATP5O protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-213 aa of BC021233 Sequence: MAAPAVSGLSRQVRCFSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV Predict reactive species\nFull Name: ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit\nCalculated Molecular Weight: 23 kDa\nObserved Molecular Weight: 23-25 kDa\nGenBank Accession Number: BC021233\nGene Symbol: ATP5O\nGene ID (NCBI): 539\nRRID: AB_2882049\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P48047\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888056291497,"sku":"66696-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66696-1-ig","provider":"Iright","version":"1.0","type":"link"}