{"product_id":"proteintech-66717-1-ig","title":"Proteintech, 66717-1-Ig, STAT6 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe STAT6 (66717-1-Ig) by Proteintech is a Monoclonal antibody targeting STAT6 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n66717-1-Ig targets STAT6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  HepG2 cells,  NIH\/3T3 cells,  HSC-T6 cells,  RAW 264.7 cells,  K-562 cells,  Jurkat cells\nPositive IHC detected in: human appendicitis tissue, human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSTAT6, also named as Signal transducer and activator of transcription 6, is a 847 amino acid protein, which belongs to the transcription factor STAT family. STAT6 forms a homodimer or a heterodimer with a related family member. STAT6 translocates into the nucleus in response to phosphorylation. STAT6 is Involved in IL4\/interleukin-4- and IL3\/interleukin-3-mediated signaling.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag0410 Product name: Recombinant human STAT6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 368-567 aa of BC005823 Sequence: IKRCERKGTESVTEEKCAVLFSASFTLGPGKLPIQLQALSLPLVVIVHGNQDNNAKATILWYNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQKIFNDNSLSMEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIGFISKQYVTSLLLNEPDGTFLLRFSDSE Predict reactive species\nFull Name: signal transducer and activator of transcription 6, interleukin-4 induced\nCalculated Molecular Weight: 100 kDa\nObserved Molecular Weight: 95 kDa\nGenBank Accession Number: BC005823\nGene Symbol: STAT6\nGene ID (NCBI): 6778\nRRID: AB_2882068\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P42226\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887999144105,"sku":"66717-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66717-1-ig","provider":"Iright","version":"1.0","type":"link"}