{"product_id":"proteintech-66722-1-ig","title":"Proteintech, 66722-1-Ig, Factor VIII Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Factor VIII (66722-1-Ig) by Proteintech is a Monoclonal antibody targeting Factor VIII in WB, ELISA applications with reactivity to human samples\n66722-1-Ig targets Factor VIII in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma tissue, human blood tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nF8, also named as  FVIII, AHF, and F8C, belongs to the multicopper oxidase family. F8, along with calcium and phospholipid, acts as a cofactor for factor IXa when it converts factor X to the activated form, factor Xa. FVIII is translated into a single-chain polypeptide (SCh) with the A1-A2-B-A3-C1-C2 domain, which can undergo glycosylation, sulfonation, and variable cleavage. The FVIII molecule is a heterodimer composed of a heavy chain (HCh, A1-A2-B domain, 90-210 kDa) and a light chain (LCh, A3-C1-C2 domain, 70-80 kDa)(PMID: 28109042; 18650448; 29292164). This antibody can recognize the light chain.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag15772 Product name: Recombinant human F8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 2144-2351 aa of BC022513 Sequence: VFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY Predict reactive species\nFull Name: coagulation factor VIII, procoagulant component\nCalculated Molecular Weight: 2351 aa, 267 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC022513\nGene Symbol: F8\nGene ID (NCBI): 2157\nRRID: AB_2882073\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P00451\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888041447593,"sku":"66722-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66722-1-ig","provider":"Iright","version":"1.0","type":"link"}