{"product_id":"proteintech-66723-1-ig","title":"Proteintech, 66723-1-Ig, HSPH1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe HSPH1 (66723-1-Ig) by Proteintech is a Monoclonal antibody targeting HSPH1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, mouse samples\n66723-1-Ig targets HSPH1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  MCF-7 cells,  Jurkat cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:20000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHSP105, also known as HSP110 or HSPH1, belongs to the heat shock protein (HSP) family. Human HSP105 is a high-molecular-weight chaperone protein expressed at constitutively low levels as a cytoplasmic α-isoform and as an inducible nuclear β-isoform on exposure to various forms of stress. HSP105 is constitutively overexpressed in several solid tumors, including melanoma, breast, thyroid, and gastroenteric cancers, and exerts antiapoptotic functions. Recently HSP105 has been identified as a novel candidate biomarker of lymphoma aggressiveness. Western blot analysis using this antibody detected the phosphorylated protein around 110 kDa in various lysates.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag27521 Product name: Recombinant human HSPH1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 508-858 aa of BC037553 Sequence: MSSEADMECLNQRPPENPDTDKNVQQDNSEAGTQPQVQTDAQQTSQSPPSPELTSEENKIPDADKANEKKVDQPPEAKKPKIKVVNVELPIEANLVWQLGKDLLNMYIETEGKMIMQDKLEKERNDAKNAVEEYVYEFRDKLCGPYEKFICEQDHQNFLRLLTETEDWLYEEGEDQAKQAYVDKLEELMKIGTPVKVRFQEAEERPKMFEELGQRLQHYAKIAADFRNKDEKYNHIDESEMKKVEKSVNEVMEWMNNVMNAQAKKSLDQDPVVRAQEIKTKIKELNNTCEPVVTQPKPKIESPKLERTPNGPNIDKKEEDLEDKNNFGAEPPHQNGECYPNEKNSVNMDLD Predict reactive species\nFull Name: heat shock 105kDa\/110kDa protein 1\nCalculated Molecular Weight: 858 aa, 97 kDa\nObserved Molecular Weight: 110 kDa\nGenBank Accession Number: BC037553\nGene Symbol: HSPH1\nGene ID (NCBI): 10808\nRRID: AB_2882074\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q92598\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888284258473,"sku":"66723-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66723-1-ig","provider":"Iright","version":"1.0","type":"link"}