{"product_id":"proteintech-66745-1-ig","title":"Proteintech, 66745-1-Ig, YTHDF1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe YTHDF1 (66745-1-Ig) by Proteintech is a Monoclonal antibody targeting YTHDF1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n66745-1-Ig targets YTHDF1 in WB, IHC, IF, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells,  HeLa cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cellls\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: human colon cancer tissue, human breast cancer tissue,  mouse testis tissue,  rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nYTHDF1, also named as YTH domain-containing family protein 1 or C20orf21, is a 559 amino acid protein, which localizes in the cytoplasm. YTHDF1 specifically recognizes and binds N6-methyladenosine (m6A)-containing mRNAs, and promotes mRNA translation efficiency. M6A is a modification present at internal sites of mRNAs and some non-coding RNAs and plays a role in the efficiency of mRNA splicing, processing and stability. YTHDF1 acts as a regulator of mRNA translation efficiency: promotes ribosome loading to m6A-containing mRNAs and interacts with translation initiation factors eIF3 (EIF3A or EIF3B) to facilitate translation initiation. YTHDF1 exists two isoform and calculated molecular weight of isoforms are 61 kDa and 21 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag11633 Product name: Recombinant human YTHDF1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 210-559 aa of BC050284 Sequence: VALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPVMGGGLPPPPIKHNMDIGTWDNKGPVPKAPVPQQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAAFGQSGGAGSDSNSPGNVQPNSAPSVESHPVLEKLKAAHSYNPKEFEWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIISSYKHTTSIFDDFAHYEKRQEEEEVVRKERQSRNKQ Predict reactive species\nFull Name: YTH domain family, member 1\nCalculated Molecular Weight: 559 aa, 61 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC050284\nGene Symbol: YTHDF1\nGene ID (NCBI): 54915\nRRID: AB_2882093\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9BYJ9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887989084329,"sku":"66745-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66745-1-ig","provider":"Iright","version":"1.0","type":"link"}