{"product_id":"proteintech-66759-1-ig","title":"Proteintech, 66759-1-Ig, PSMB8 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PSMB8 (66759-1-Ig) by Proteintech is a Monoclonal antibody targeting PSMB8 in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n66759-1-Ig targets PSMB8 in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HSC-T6 cells,  Raji cells,  Ramos cells\nPositive IHC detected in: human lung cancer tissue, human liver cancer tissue,  human oesophagus cancer tissue,  mouse colon tissue,  mouse stomach tissue,  rat colon tissue,  rat stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human lung cancer tissue, human liver cancer tissue\nPositive IF\/ICC detected in: HepG2 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPSMB8(Proteasome subunit beta type-8) is also named as LMP7, PSMB5i, RING10, Y2 and belongs to the peptidase T1B family. The gene encodes the chymotrypsin-like catalytic subunit of the immunoproteasome(PMID: 19525961). PSMB8 has a role in controlling pathogenic immune responses and may be a target in autoimmune disorders. Its prosequence is not essential for incorporation of PSMB8 into the maturing proteasome, but it increased the efficiency of PSMB8 incorporation and proteasome maturation(PMID: 10926487). The pro-PSMB8 is a 276aa protein with the molecular mass of 30 kDa, and the mature form is about 23kDa due to the 72aa propeptide cleaved. Defects in PSMB8 are the cause of Nakajo syndrome (NKJO).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6780 Product name: Recombinant human PSMB8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-272 aa of BC001114 Sequence: MLIGTPTPRDTTPSSWLTSSLLVEAAPLDDTTLPTPVSSGCPGLEPTEFFQSLGGDGERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ Predict reactive species\nFull Name: proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7)\nCalculated Molecular Weight: 30 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC001114\nGene Symbol: PSMB8\nGene ID (NCBI): 5696\nRRID: AB_2882105\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P28062\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888032600233,"sku":"66759-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66759-1-ig","provider":"Iright","version":"1.0","type":"link"}