{"product_id":"proteintech-66768-1-ig","title":"Proteintech, 66768-1-Ig, AGR2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe AGR2 (66768-1-Ig) by Proteintech is a Monoclonal antibody targeting AGR2 in WB, IHC, IF\/ICC, IF-P, FC (Intra), ELISA applications with reactivity to human, pig samples\n66768-1-Ig targets AGR2 in WB, IHC, IF\/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig stomach tissue, T-47D cells,  HT-29 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human colon cancer tissue\nPositive IF\/ICC detected in: HT-29 cells, A549 cells\nPositive FC (Intra) detected in: HT-29 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:150-1:600\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAGR2, also named AG2 or HPC8, encodes anterior gradient protein 2 homolog which belongs to the AGR family. It is a secreted protein localized in endoplasmic reticulum. AGR2 plays roles in MUC2 post-transcriptional synthesis,secretion and production of mucus by intestinal cells. AGR2 was significantly elevated in the pancreatic juice from patients with pre-malignant conditions as well as pancreatic cancer compared to control pancreatic juice samples. AGR2 levels in pancreatic juice could potentially be used to aide in assessment of high-risk patients undergoing endoscopic procedures.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag2919 Product name: Recombinant human AGR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 17-175 aa of BC015503 Sequence: YTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL Predict reactive species\nFull Name: anterior gradient homolog 2 (Xenopus laevis)\nCalculated Molecular Weight: 175 aa, 20 kDa\nObserved Molecular Weight: 17 kDa\nGenBank Accession Number: BC015503\nGene Symbol: AGR2\nGene ID (NCBI): 10551\nRRID: AB_2882114\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O95994\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888035352745,"sku":"66768-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66768-1-ig","provider":"Iright","version":"1.0","type":"link"}