{"product_id":"proteintech-66771-1-ig","title":"Proteintech, 66771-1-Ig, SLC25A1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC25A1 (66771-1-Ig) by Proteintech is a Monoclonal antibody targeting SLC25A1 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples\n66771-1-Ig targets SLC25A1 in WB, IP, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, Jurkat cells,  HSC-T6 cells,  NIH\/3T3 cells,  NK-92 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC25A1, also known as CIC or CTP, is a mitochondrial citrate transporter that exports citrate from the mitochondria to the cytosol. SLC25A1 is highly expressed in several tumor types. Recently it has been identified as a novel transcriptional target of mutant p53 and a negative tumor prognostic marker. In addition, defects in SLC25A1 has been found as a cause of combined D-2- and L-2-hydroxyglutaric aciduria. This antibody specifically recognized the endogenous SLC25A1; no protein was detected in cells from subjects containing two alleles with truncating mutations with this antibody. (24681808, 23561848)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nCited Reactivity: mouse\nHost \/ Isotype: Mouse \/ IgG3\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag7520 Product name: Recombinant human SLC25A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-311 aa of BC004980 Sequence: MPAPRAPRALAAAAPASGKAKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGLSSLLYGSIPKAAVRFGMFEFLSNHMRDAQGRLDSTRGLLCGLGAGVAEAVVVVCPMETIKVKFIHDQTSPNPKYRGFFHGVREIVREQGLKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYRGDNPNKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVFVIYDEVVKLLNKVWKTD Predict reactive species\nFull Name: solute carrier family 25 (mitochondrial carrier; citrate transporter), member 1\nCalculated Molecular Weight: 34 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC004980\nGene Symbol: SLC25A1\nGene ID (NCBI): 6576\nRRID: AB_2882117\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P53007\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888075755689,"sku":"66771-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66771-1-ig","provider":"Iright","version":"1.0","type":"link"}