{"product_id":"proteintech-66803-1-ig","title":"Proteintech, 66803-1-Ig, CD82 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD82 (66803-1-Ig) by Proteintech is a Monoclonal antibody targeting CD82 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n66803-1-Ig targets CD82 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, Jurkat cells,  Raji cells,  K-562 cells,  RAW 264.7 cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human tonsillitis tissue, human ovary tumor tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD82 is a membrane glycoprotein and belongs to the tetraspanin superfamily, many of which are implicated in the regulation of cell motility, morphology, fusion, signaling, fertilization, and differentiation. CD82 was originally identified as a suppressor of metastasis located on human chromosome 11p11.2 in prostate carcinoma. The majority of evidence indicates that CD82 expression is downregulated or abolished in a variety of malignant tumors. CD82 is present at high levels in human monocyte and macrophage lineages and in various epithelial cells in the prostate, lung, pancreas and many other tissues. In epithelial cells, CD82 is implicated in diverse biological processes such as cell adhesion, migration, apoptosis and morphogenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag17513 Product name: Recombinant human CD82 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 35-264 aa of BC000726 Sequence: LADKSSFISVLQTSSSSLRMGAYVFIGVGAVTMLMGFLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIVELLGMVLSICLCRHVHSEDYSKV Predict reactive species\nFull Name: CD82 molecule\nCalculated Molecular Weight: 30 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: BC000726\nGene Symbol: CD82\nGene ID (NCBI): 3732\nRRID: AB_2882146\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P27701\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888026210473,"sku":"66803-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66803-1-ig","provider":"Iright","version":"1.0","type":"link"}