{"product_id":"proteintech-66804-1-ig","title":"Proteintech, 66804-1-Ig, VE-cadherin\/CD144 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe VE-cadherin\/CD144 (66804-1-Ig) by Proteintech is a Monoclonal antibody targeting VE-cadherin\/CD144 in WB, IHC, IF-P, ELISA applications with reactivity to human samples\n66804-1-Ig targets VE-cadherin\/CD144 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue\nPositive IHC detected in: human breast cancer tissue, human tonsillitis tissue,  human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human placenta tissue\nPositive IF\/ICC detected in: HUVEC cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:750-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCadherins are a family of transmembrane glycoproteins that mediate calcium-dependent cell-cell adhesion and play an important role in the maintenance of normal tissue architecture. Vascular endothelial cadherin (VE-cadherin), also known as Cadherin-5 (CDH5) or CD144, is a member of the type II classical cadherin family of cell adhesion proteins (PMID: 21269602). VE-cadherin is expressed specifically in endothelial cells and mediates homophilic adhesion in the vascular endothelium (PMID: 1522121; 8555485; 21269602). VE-cadherin plays a role in the organization of lateral endothelial junctions and in the control of permeability properties of vascular endothelium (PMID: 1522121). VE-cadherin has also been shown to be required for angiogenesis (PMID: 16473763; 18162609).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag27501 Product name: Recombinant human CDH5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 54-241 aa of NM_001795 Sequence: MHIDEEKNTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIKVHDVNDNWPVFTHRLFNASVPESSAVGTSVISVTAVDADDPTVGDHASVMYQILKGKEYFAIDNSGRIITITKSLDREKQARYEIVVEARDAQGLRGDSGT Predict reactive species\nFull Name: cadherin 5, type 2 (vascular endothelium)\nCalculated Molecular Weight: 88 kDa\nObserved Molecular Weight: 125 kDa, 100 kDa\nGenBank Accession Number: NM_001795\nGene Symbol: VE-cadherin\nGene ID (NCBI): 1003\nRRID: AB_2882147\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P33151\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887980597417,"sku":"66804-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66804-1-ig","provider":"Iright","version":"1.0","type":"link"}