{"product_id":"proteintech-66805-1-ig","title":"Proteintech, 66805-1-Ig, AQP1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe AQP1 (66805-1-Ig) by Proteintech is a Monoclonal antibody targeting AQP1 in WB, IHC, IF-P, ELISA applications with reactivity to Human, pig samples\n66805-1-Ig targets AQP1 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human heart tissue, human skeletal muscle tissue,  pig kidney tissue\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:20000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAQP1 is a member of aquaporins (AQPs) that are small membrane-spanning proteins facilitating water transport. AQP1 is expressed in most tissues in the mammalian body. Alterations of AQP1 expression have been linked to variety of diseases, including cancer. The predicted molecular weight of AQP1 is around 28 kDa, while highly glycosylated form can also be observed around 40-45 kDa. (1530176)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, pig\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag14093 Product name: Recombinant human AQP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 220-269 aa of BC022486 Sequence: GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK Predict reactive species\nFull Name: aquaporin 1 (Colton blood group)\nCalculated Molecular Weight: 269 aa, 29 kDa\nObserved Molecular Weight: 28 kDa, 38-40 kDa\nGenBank Accession Number: BC022486\nGene Symbol: AQP1\nGene ID (NCBI): 358\nRRID: AB_2882148\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P29972\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888014020777,"sku":"66805-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66805-1-ig","provider":"Iright","version":"1.0","type":"link"}