{"product_id":"proteintech-66835-1-ig","title":"Proteintech, 66835-1-Ig, IRF5 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe IRF5 (66835-1-Ig) by Proteintech is a Monoclonal antibody targeting IRF5 in WB, ELISA applications with reactivity to human, mouse samples\n66835-1-Ig targets IRF5 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  THP-1 cells,  RAW 264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIRF5, also named as SLEB10, contians one IRF tryptophan pentad repeat DNA-binding domain and belongs to the IRF family. It is a transcription factor involved in the induction of interferons IFNA and INFB and inflammatory cytokines upon virus infection. It is activated by TLR7 or TLR8 signaling. Genetic variations in IRF5 are associated with susceptibility to inflammatory bowel disease type 14 (IBD14)  and systemic lupus erythematosus type 10 (SLEB10). IRF5 is also used as M1 marcrophage lineage marker. Alternative splice variant encoding different isoforms exist.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag5442 Product name: Recombinant human IRF5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 173-498 aa of BC004201 Sequence: TLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLEATQEQVELFGPISLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDSCPNPIQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMHPAGMQ Predict reactive species\nFull Name: interferon regulatory factor 5\nCalculated Molecular Weight: 56 kDa\nObserved Molecular Weight: 56 kDa\nGenBank Accession Number: BC004201\nGene Symbol: IRF5\nGene ID (NCBI): 3663\nRRID: AB_2882178\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q13568\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888287961257,"sku":"66835-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66835-1-ig","provider":"Iright","version":"1.0","type":"link"}