{"product_id":"proteintech-66849-1-ig","title":"Proteintech, 66849-1-Ig, CPLX2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CPLX2 (66849-1-Ig) by Proteintech is a Monoclonal antibody targeting CPLX2 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig samples\n66849-1-Ig targets CPLX2 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse cerebellum tissue,  rat brain tissue,  rat cerebellum tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nComplexins are soluble proteins that regulate the activity of soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) complexes necessary for vesicle fusion. Neuronal specific complexin 1 (CPLX1) has inhibitory and stimulatory effects on exocytosis by clamping trans-SNARE complexes in a prefusion state and promoting conformational changes to facilitate membrane fusion following cell stimulation. Complexin2 (CPLX2) is a pre-synaptic protein believed to regulate neurotransmitter release from pre-synaptic terminals, it is downregulated in schizophrenic patients suffering from depression, animal models of depression and neurological disorders such as Huntington's disease in which depression is a major symptom.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag27949 Product name: Recombinant human CPLX2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-134 aa of BC093706 Sequence: MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK Predict reactive species\nFull Name: complexin 2\nCalculated Molecular Weight: 134 aa, 15 kDa\nObserved Molecular Weight: 18-20 kDa\nGenBank Accession Number: BC093706\nGene Symbol: CPLX2\nGene ID (NCBI): 10814\nRRID: AB_2882189\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q6PUV4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888111308969,"sku":"66849-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66849-1-ig","provider":"Iright","version":"1.0","type":"link"}