{"product_id":"proteintech-66881-1-ig","title":"Proteintech, 66881-1-Ig, Flotillin 2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Flotillin 2 (66881-1-Ig) by Proteintech is a Monoclonal antibody targeting Flotillin 2 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n66881-1-Ig targets Flotillin 2 in WB, IHC, IF\/ICC, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig brain tissue, A431 cells,  HeLa cells,  HEK-293 cells,  A549 cells,  NIH\/3T3 cells,  rabbit brain tissue,  rat brain tissue,  mouse brain tissue\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:20000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:2000-1:8000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFlotillins are membrane-associated proteins that contain two homologous isoforms, flotillin 1 (FLOT1) and flotillin 2 (FLOT2). They are highly conserved and widely expressed proteins that commonly used as markers of lipid rafts. Flotillins are involved in various signaling pathways, cell adhesion, membrane trafficking and axonal growth.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28308 Product name: Recombinant human Flotillin 2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-379 aa of BC017292 Sequence: MTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV Predict reactive species\nFull Name: flotillin 2\nCalculated Molecular Weight: 379 aa, 42 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC017292\nGene Symbol: Flotillin 2\nGene ID (NCBI): 2319\nRRID: AB_2882213\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q14254\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888000651433,"sku":"66881-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66881-1-ig","provider":"Iright","version":"1.0","type":"link"}