{"product_id":"proteintech-66899-1-ig","title":"Proteintech, 66899-1-Ig, SPTLC1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPTLC1 (66899-1-Ig) by Proteintech is a Monoclonal antibody targeting SPTLC1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n66899-1-Ig targets SPTLC1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293 cells,  RAW 264.7 cells,  HT-29 cells,  HeLa cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  NIH\/3T3 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:490-1:1962\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPTLC1 is a subunit of serine palmitoyltransferase (SPT) which is the key enzyme in sphingolipid biosynthesis and is essential for embryogenesis and cell survival. Mutations in the SPTLC1 gene (C133W, C133Y, V144D, and G387A) were reported to be responsible for the development of an inherited sensory neuropathy (hereditary sensory neuropathy type I, HSN1).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag7876 Product name: Recombinant human SPTLC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-143 aa of BC007085 Sequence: MATATEQWVLVEMVQALYEAPAYHLILEGILILWIIRLLFSKTYKLQERSDLTVKEKEELIEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFE Predict reactive species\nFull Name: serine palmitoyltransferase, long chain base subunit 1\nCalculated Molecular Weight: 53 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC007085\nGene Symbol: SPTLC1\nGene ID (NCBI): 10558\nRRID: AB_2882228\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O15269\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888050294953,"sku":"66899-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66899-1-ig","provider":"Iright","version":"1.0","type":"link"}