{"product_id":"proteintech-66916-1-ig","title":"Proteintech, 66916-1-Ig, TFG Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TFG (66916-1-Ig) by Proteintech is a Monoclonal antibody targeting TFG in WB, IHC, ELISA applications with reactivity to Human, Pig samples\n66916-1-Ig targets TFG in WB, IHC, ELISA applications and shows reactivity with Human, Pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NCI-H1299 cells, A549 cells,  MCF-7 cells,  HEK-293 cells,  PC-3 cells,  LNCaP cells\nPositive IHC detected in: human breast cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProtein TFG (TRK-fused gene protein) plays a role in regulating phosphotyrosine-specific phosphatase-1 activity. Mutations in TFG may have important clinical relevance for current therapeutic strategies to treat metastatic melanoma. Defects in TFG are a cause of thyroid papillary carcinoma (TPC), a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue. Hereditary motor and sensory neuropathy with proximal dominant involvement (HMSN-P) is an autosomal-dominant neurodegenerative disorder characterized by widespread fasciculations, proximal-predominant muscle weakness, and atrophy followed by distal sensory involvement. Recent genetic investigation indicates that formation of TFG-containing cytoplasmic inclusions and concomitant mislocalization of TAR DNA-binding protein 43 kDa (TDP-43) underlie motor neuron degeneration in HMSN-P. Pathological overlap of proteinopathies involving TFG and TDP-43 highlights a new pathway leading to motor neuron degeneration.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Pig\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag27697 Product name: Recombinant human TFG protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-208 aa of BC023599 Sequence: MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPSAPAEDRSGTPD Predict reactive species\nFull Name: TRK-fused gene\nCalculated Molecular Weight: 400 aa, 43 kDa\nObserved Molecular Weight: 50-55 kDa\nGenBank Accession Number: BC023599\nGene Symbol: TFG\nGene ID (NCBI): 10342\nRRID: AB_2882243\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q92734\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888330494121,"sku":"66916-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66916-1-ig","provider":"Iright","version":"1.0","type":"link"}