{"product_id":"proteintech-66926-1-ig","title":"Proteintech, 66926-1-Ig, GPNMB Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPNMB (66926-1-Ig) by Proteintech is a Monoclonal antibody targeting GPNMB in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n66926-1-Ig targets GPNMB in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SK-BR-3 cells, A549 cells,  HT-1080 cells,  RT-4 cells,  MG-63 cells,  FaDu cells,  MDA-MB-468 cells,  PC-12 cells,  RAw 264.7 cells,  4T1 cells,  HeLa cells,  A375 cells,  U-251 cells,  THP-1 cells,  U-937 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPNMB also known as HGFIN, osteoactivin, and DC-HIL, is a type I membrane glycoprotein involved in various biological processes, including inflammation, invasion and metastasis of malignant tumors, cell differentiation, and tissue regeneration. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB acts as an osteogenic factor that stimulates osteoblast differentiation in vivo and in vitro.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag26747 Product name: Recombinant human GPNMB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 38-158 aa of BC011595 Sequence: MREHNQLNGWSSDENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPD Predict reactive species\nFull Name: glycoprotein (transmembrane) nmb\nCalculated Molecular Weight: 64 kDa\nObserved Molecular Weight: 64-70 kDa\nGenBank Accession Number: BC011595\nGene Symbol: GPNMB\nGene ID (NCBI): 10457\nRRID: AB_2882253\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q14956\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887991181481,"sku":"66926-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66926-1-ig","provider":"Iright","version":"1.0","type":"link"}