{"product_id":"proteintech-66944-1-ig","title":"Proteintech, 66944-1-Ig, RAB27B Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAB27B (66944-1-Ig) by Proteintech is a Monoclonal antibody targeting RAB27B in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n66944-1-Ig targets RAB27B in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, human peripheral blood platelets,  MCF-7 cells,  HeLa cells,  U-87 MG cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\nPositive FC (Intra) detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe Rab27 GTPase subfamily consists of two closely related homologs, Rab27a and Rab27b. Northern blot analysis revealed that Rab27b is expressed significantly only in testis, in which the predominant transcript was 1.4 kb in size. An 8-kb mRNA of unknown origin was detected in many tissues. Rab27b is associated with tubulovesicle membranes in the parietal cell and Rab27b may play a role in stimulation-associated membrane recruitment and gastric acid secretion. Rab27b is recently reported as a marker for breast cancer progression. It regulates invasive growth and metastasis in ER-positive breast cancer cell lines, and increased expression is associated with poor prognosis in humans.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag18756 Product name: Recombinant human RAB27B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-218 aa of BC027474 Sequence: MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC Predict reactive species\nFull Name: RAB27B, member RAS oncogene family\nCalculated Molecular Weight: 218 aa, 25 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC027474\nGene Symbol: RAB27B\nGene ID (NCBI): 5874\nRRID: AB_2882268\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O00194\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888016511145,"sku":"66944-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66944-1-ig","provider":"Iright","version":"1.0","type":"link"}