{"product_id":"proteintech-66954-1-ig","title":"Proteintech, 66954-1-Ig, FGFR3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe FGFR3 (66954-1-Ig) by Proteintech is a Monoclonal antibody targeting FGFR3 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n66954-1-Ig targets FGFR3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, L02 cells,  L-929 cells,  HeLa cells,  HEK-293 cells,  HepG2 cells,  A549 cells,  NCI-H1299 cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFibroblast growth factors (FGFs) are polypeptide growth factors involved in a variety of activities including mitogenesis, angiogenesis, and wound healing (PMID: 1847508). The human FGF receptor family, a subfamily of receptor tyrosine kinases (RTKs), comprises of four family members-FGFR1, FGFR2, FGFR3, and FGFR4 (PMID: 23900974). Each receptor contains an extracellular domain with either two or three immunoglobulin-like domains, a transmembrane domain, and a cytoplasmic tyrosine kinase domain. FGFR3 binds acidic and basic fibroblast GH and plays a role in bone development and maintenance. Mutations in the FGFR3 gene lead to craniosynostosis and multiple types of skeletal dysplasia. Due to frequent mutations in certain cancers, the FGFR3 gene has also been associated with tumor progression.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag26290 Product name: Recombinant human FGFR3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 23-125 aa of NM_000142 Sequence: MESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRV Predict reactive species\nFull Name: fibroblast growth factor receptor 3\nCalculated Molecular Weight: 87 kDa\nObserved Molecular Weight: 125-135 kDa\nGenBank Accession Number: NM_000142\nGene Symbol: FGFR3\nGene ID (NCBI): 2261\nRRID: AB_2882277\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P22607\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887991738537,"sku":"66954-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66954-1-ig","provider":"Iright","version":"1.0","type":"link"}