{"product_id":"proteintech-66975-1-ig","title":"Proteintech, 66975-1-Ig, EPO\/Erythropoietin Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe EPO\/Erythropoietin (66975-1-Ig) by Proteintech is a Monoclonal antibody targeting EPO\/Erythropoietin in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n66975-1-Ig targets EPO\/Erythropoietin in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: recombinant human EPO (cat.NO. HZ-1168)\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nErythropoietin (Epo) is a member of the EPO\/TPO family and encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. Its effect is realized by binding erythropoietin receptor (EpoR) expressed on erythroid progenitor cells. EpoR, is a glycoprotein expressed on megakaryocytes, erythroid progenitors and endothelial cells. Epo also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag23054 Product name: Recombinant human EPO protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 29-193 aa of BC093628 Sequence: PPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR Predict reactive species\nFull Name: erythropoietin\nCalculated Molecular Weight: 193 aa, 21 kDa\nGenBank Accession Number: BC093628\nGene Symbol: EPO\/Erythropoietin\nGene ID (NCBI): 2056\nRRID: AB_2882295\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P01588\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888015233193,"sku":"66975-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66975-1-ig","provider":"Iright","version":"1.0","type":"link"}