{"product_id":"proteintech-66983-1-ig","title":"Proteintech, 66983-1-Ig, TRPV1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRPV1 (66983-1-Ig) by Proteintech is a Monoclonal antibody targeting TRPV1 in WB, ELISA applications with reactivity to human samples\n66983-1-Ig targets TRPV1 in WB, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, MDA-MB-468 cells,  T-47D cells,  HEK-293 cells,  Y79 cells,  HUVEC cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRPV1, also named as VR1 or OTRPC1, belongs to the transient receptor potential (TRP) family and TRPV subfamily (PMID: 17579562). TRPV1 is a ligand-activated non-selective calcium permeant cation channel expressed predominantly by sensory neurons (PMID: 10821274). It is involved in detection of noxious chemical and thermal stimuli. TRPV1 plays an important role in inflammatory thermal hyperalgesia (PMID: 10764638; 10821274).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, sheep\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag18683 Product name: Recombinant human TRPV1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-203 aa of BC132820 Sequence: MKKWSSTDLGAAADPLQKDTCPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQNNCQDLESLLLFLQKSKKHLTDNEFKDPETGKTCLLKAMLNLHDGQNTTIPLLLEIARQTDSLKELVNASYTDSYYKGQ Predict reactive species\nFull Name: transient receptor potential cation channel, subfamily V, member 1\nCalculated Molecular Weight: 839 aa, 95 kDa\nObserved Molecular Weight: 105 kDa\nGenBank Accession Number: BC132820\nGene Symbol: TRPV1\nGene ID (NCBI): 7442\nRRID: AB_2882302\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q8NER1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887979548841,"sku":"66983-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-66983-1-ig","provider":"Iright","version":"1.0","type":"link"}