{"product_id":"proteintech-67000-1-ig","title":"Proteintech, 67000-1-Ig, PTPRO Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PTPRO (67000-1-Ig) by Proteintech is a Monoclonal antibody targeting PTPRO in WB, IHC, IF-P, ELISA applications with reactivity to human, pig samples\n67000-1-Ig targets PTPRO in WB, IHC, IF-P, ELISA applications and shows reactivity with human, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig kidney tissue\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPTPRO(receptor-type tyrosine-protein phosphatase O) is also named as GLEPP1, PTPU2 and belongs to the protein-tyrosine phosphatase family. The protein is a receptor-like membrane protein tyrosine phosphatase expressed at the apical membrane of the podocyte foot processes in the kidney(PMID:21722858). The 1,159-amino acid predicted mature protein contains a large extracellular domain, a single transmembrane domain, and a single intracellular PTPase domain. Defects in PTPRO are the cause of nephrotic syndrome type 6 (NPHS6). In reducing conditions, PTPRO can form a smear from 180 to 220 kDa; In non-reducing conditions, a band appeares around 350 kDa, which likely represents the dimeric form of full-length PTPRO (PMID: 19573017).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag8284 Product name: Recombinant human PTPRO protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 298-597 aa of BC035960 Sequence: YWWDSASAAPESEDEFVSVLPMEYENNSTLSETEKSTSGSFSFFPVQMILTWLPPKPPTAFDGFHIHIEREENFTEYLMVDEEAHEFVAELKEPGKYKLSVTTFSSSGSCETRKSQSAKSLSFYISPSGEWIEELTEKPQHVSVHVLSSTTALMSWTSSQENYNSTIVSVVSLTCQKQKESQRLEKQYCTQVNSSKPIIENLVPGAQYQVVIYLRKGPLIGPPSDPVTFAIVPTGIKDLMLYPLGPTAVVLSWTRPYLGVFRKYVVEMFYFNPATMTSEWTTYYEIAATVSLTASVVIFP Predict reactive species\nFull Name: protein tyrosine phosphatase, receptor type, O\nCalculated Molecular Weight: 138 kDa\nObserved Molecular Weight: 160 kDa, 180-220 kDa\nGenBank Accession Number: BC035960\nGene Symbol: PTPRO\nGene ID (NCBI): 5800\nRRID: AB_2882317\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q16827\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888022900905,"sku":"67000-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67000-1-ig","provider":"Iright","version":"1.0","type":"link"}