{"product_id":"proteintech-67010-1-ig","title":"Proteintech, 67010-1-Ig, RASGRF1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RASGRF1 (67010-1-Ig) by Proteintech is a Monoclonal antibody targeting RASGRF1 in WB, ELISA applications with reactivity to rat, pig samples\n67010-1-Ig targets RASGRF1 in WB, ELISA applications and shows reactivity with rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig cerebellum tissue, pig brain tissue,  rat brain tissue,  rat cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRasGRF1, a member of calmodulin-activated guanine-nucleotide exchange factors (GEFs), highly expressed at the synaptic junctions of the central nervous system (CNS). It is similar to the Saccharomyces cerevisiae CDC25. RASGRF1 serves as an in vivo activator for H-RAS and members of the R-RAS and RAC subfamilies. Several studies have shown that RasGRF1 also binds to microtubules and participate in the regulation of neurite outgrowth. RasGRF1 has been implicated in neuronal excitability. The studies of the similar gene in mouse suggested that the Ras-GEF activity of this protein in brain can be activated by Ca2+ influx, muscarinic receptors, and G protein beta-gamma subunit. Mouse studies also indicated that the Ras-GEF signaling pathway mediated by this protein may be important for long-term memory.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: rat, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6937 Product name: Recombinant human RASGRF1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 832-1181 aa of BC040275 Sequence: QSDDGDTETSPTKSPTTPKSVKNKNSSEFPLFSYNNGVVMTSCRELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNDELKCKVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEITQMAEGVKAEPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTKHFNDISNLIASEIIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQVRAGGWHHCLPGAGLGLGQEDPWAGHWASTSGQRTGLRSNTPR Predict reactive species\nFull Name: Ras protein-specific guanine nucleotide-releasing factor 1\nCalculated Molecular Weight: 134 kDa\nObserved Molecular Weight: 145 kDa\nGenBank Accession Number: BC040275\nGene Symbol: RASGRF1\nGene ID (NCBI): 5923\nRRID: AB_2882327\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q13972\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888317681833,"sku":"67010-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67010-1-ig","provider":"Iright","version":"1.0","type":"link"}