{"product_id":"proteintech-67011-1-ig","title":"Proteintech, 67011-1-Ig, PLCG2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PLCG2 (67011-1-Ig) by Proteintech is a Monoclonal antibody targeting PLCG2 in WB, IHC, ELISA applications with reactivity to human samples\n67011-1-Ig targets PLCG2 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Ramos cells, Raji cells,  Karpas-422 cells,  rabbit spleen tissue,  Daudi cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPhospholipase C-gamma2 (PLCG2) is a transmembrane signaling enzyme that catalyzes the conversion of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate to 1D-myo-inositol 1,4,5-trisphosphate (IP3) and diacylglycerol (DAG) using calcium as a cofactor.IP3 and DAG are second messenger molecules important for transmitting signals from growth factor receptors and immune system receptors across the cell membrane. Mutations in this gene have been found in autoinflammation, antibody deficiency, and immune dysregulation syndrome and familial cold autoinflammatory syndrome 3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag24355 Product name: Recombinant human PLCG2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 150-313 aa of BC007565 Sequence: IYSVDQTRRNSISLRELKTILPLINFKVSSAKFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASAVYLRDFQRFLIHEQQEHWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENSIWDEKYDAVDMQD Predict reactive species\nFull Name: phospholipase C, gamma 2 (phosphatidylinositol-specific)\nCalculated Molecular Weight: 148 kDa\nObserved Molecular Weight: 148 kDa\nGenBank Accession Number: BC007565\nGene Symbol: PLCG2\nGene ID (NCBI): 5336\nRRID: AB_2882328\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P16885\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888032075945,"sku":"67011-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67011-1-ig","provider":"Iright","version":"1.0","type":"link"}