{"product_id":"proteintech-67015-1-ig","title":"Proteintech, 67015-1-Ig, MAP2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe MAP2 (67015-1-Ig) by Proteintech is a Monoclonal antibody targeting MAP2 in IHC, IF-P, IF-Fro, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n67015-1-Ig targets MAP2 in WB, IHC, IF-P, IF-Fro, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse brain tissue, rat cerebellum tissue,  rat brain tissue,  human brain tissue,  mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat brain tissue, mouse brain tissue\nPositive IF-Fro detected in: rat brain tissue, mouse brain tissue\nPositive FC (Intra) detected in: Neuro-2a cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)-FRO: IF-FRO : 1:1000-1:4000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMAP2 (microtubule-associated protein 2) is a cytoskeleton protein abundant in brain and has important role in neuronal morphogenesis. Multiple high molecular weight (MW) and low molecular weight (MW) MAP2 isoforms are expressed within axons, dendrites, and cell bodies. The expression of MAP2 is regulated in both a tissue- and developmentally specific manner. MAP2 antibodies have been widely used to mark the neuron or dendrite formation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, monkey\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag11349 Product name: Recombinant human MAP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 213-559 aa of BC038857 Sequence: TSAGSTDRLPYSKSGNKDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGSTDNIKYQPKGGQVRILNKKIDFSKVQSRCGSKDNIKHSAGGGNVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSNVSSSGSINLLESPQLATLAEDVTAALAKQGL Predict reactive species\nFull Name: microtubule-associated protein 2\nCalculated Molecular Weight: 200 kDa\nGenBank Accession Number: BC038857\nGene Symbol: MAP2\nGene ID (NCBI): 4133\nRRID: AB_2882331\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P11137\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887981088937,"sku":"67015-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67015-1-ig","provider":"Iright","version":"1.0","type":"link"}