{"product_id":"proteintech-67051-1-ig","title":"Proteintech, 67051-1-Ig, IL-4RA\/CD124 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-4RA\/CD124 (67051-1-Ig) by Proteintech is a Monoclonal antibody targeting IL-4RA\/CD124 in WB, ELISA applications with reactivity to human samples\n67051-1-Ig targets IL-4RA\/CD124 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, Jurkat cells,  MG-63 cells,  SCaBER cells,  HT-1376 cells,  Raji cells,  Ramos cells,  Daudi cells,  HUVEC cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL-4 receptor alpha chain (IL-4RA), also known as CD124, is a transmembrane glycoprotein expressed on a wide variety of hematopoietic and non-hematopoietic cells. It is a receptor for both IL-4 and IL-13. IL-4RA can complex with the common gamma chain (IL-2R gamma or CD132) and utilizes JAK1 and JAK2 for signal transduction, while complexes of IL-4RA with IL-13RA1 subunit mediate signals via JAK2 and Tyk2. The IL-4 response is involved in promoting Th2 differentiation. The IL-4\/IL-13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28411 Product name: Recombinant human IL-4R protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 26-232 aa of NM_000418 Sequence: MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH Predict reactive species\nFull Name: interleukin 4 receptor\nCalculated Molecular Weight: 90 kDa\nObserved Molecular Weight: 120 kDa\nGenBank Accession Number: NM_000418\nGene Symbol: IL-4R\nGene ID (NCBI): 3566\nRRID: AB_2882364\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P24394\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888286683305,"sku":"67051-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67051-1-ig","provider":"Iright","version":"1.0","type":"link"}