{"product_id":"proteintech-67070-1-ig","title":"Proteintech, 67070-1-Ig, PPP1CA Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPP1CA (67070-1-Ig) by Proteintech is a Monoclonal antibody targeting PPP1CA in WB, ELISA applications with reactivity to human, mouse, rat, pig, rabbit, zebrafish samples\n67070-1-Ig targets PPP1CA in WB, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, zebrafish samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, fetal human brain tissue,  pig brain tissue,  zebrafish tissue,  T-47D cells,  Jurkat cells,  HEK-293 cells,  rabbit brain tissue,  rat brain tissue,  mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProtein phosphatase associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Type 1 protein phosphatase (PP1), a serine\/threonine phosphatase, is essential for cell division and participates in the regulation of glycogen metabolism, muscle contractility, and protein synthesis. Four isoforms of PP1 have been characterized: PP1α, PP1δ, PP1γ1 and PP1γ2 (PMID: 9835651). It has been illustrated that PP1 dephosphorylates Rb and cdc25 during mitosis (PMID: 8384581, PMID: 1392080). A cell cycle-dependent phosphorylation at Thr320 of PP1α by cdc2 kinase inhibits PP1α activity (PMID: 9122166).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit, zebrafish\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28451 Product name: Recombinant human PPP1CA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 140-330 aa of BC001888 Sequence: CKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK Predict reactive species\nFull Name: protein phosphatase 1, catalytic subunit, alpha isoform\nCalculated Molecular Weight: 330 aa, 38 kDa\nObserved Molecular Weight: 37 kDa\nGenBank Accession Number: BC001888\nGene Symbol: PPP1CA\nGene ID (NCBI): 5499\nRRID: AB_2882379\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P62136\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887993344169,"sku":"67070-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67070-1-ig","provider":"Iright","version":"1.0","type":"link"}