{"product_id":"proteintech-67078-1-ig","title":"Proteintech, 67078-1-Ig, Alpha Sarcoglycan Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Alpha Sarcoglycan (67078-1-Ig) by Proteintech is a Monoclonal antibody targeting Alpha Sarcoglycan in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples\n67078-1-Ig targets Alpha Sarcoglycan in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human skeletal muscle tissue, human heart tissue,  pig heart tissue,  rat skeletal muscle tissue,  pig skeletal muscle tissue,  rat heart tissue,  mouse skeletal muscle tissue\nPositive IHC detected in: mouse skeletal muscle tissue, human liver tissue,  mouse heart tissue,  mouse tongue tissue,  rat heart tissue,  rat skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse heart tissue, mouse skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAlpha-sarcoglycan is a member of the sarcoglycan-sarcospan complex (SG-SSPN), which is constituted by α\/ɛ-, β-, γ-, and δ-SGs as well as SSPN. Alpha-sarcoglycan gene expression is exclusive of striated muscle and is finely regulated during myogenic differentiation, where the amount of alpha-sarcoglycan transcript is selectively increased after differentiation to myotubes (MTs).  Alpha sarcoglycan's disruption causes limb-girdle muscular dystrophy.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28800 Product name: Recombinant human SGCA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 25-289 aa of BC025702 Sequence: QTTLHPLVGRVFVHTLDHETFLSLPEHVAVPPAVHITYHAHLQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGLQVIEVTAYNRDSFDTTRQRLVLEIGDPEGPLLPYQAEFLVRSHDAEEVLPSTPASRFLSALGGLWEPGELQLLNVTSALDRGGRVPLPIEGRKEGVYIKVGSASPFSTCLKMVASPDSHARCAQGQPPLLSCYDTLAPHFRVDWCNVTLVDKSVPEPADEVPTPGDGILEHDPFFCPPTEAPDRDFLVD Predict reactive species\nFull Name: sarcoglycan, alpha (50kDa dystrophin-associated glycoprotein)\nCalculated Molecular Weight: 387 aa, 43 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC025702\nGene Symbol: alpha Sarcoglycan\nGene ID (NCBI): 6442\nRRID: AB_2882386\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q16586\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888086732969,"sku":"67078-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67078-1-ig","provider":"Iright","version":"1.0","type":"link"}