{"product_id":"proteintech-67089-1-ig","title":"Proteintech, 67089-1-Ig, CNTN2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CNTN2 (67089-1-Ig) by Proteintech is a Monoclonal antibody targeting CNTN2 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, pig samples\n67089-1-Ig targets CNTN2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig brain tissue, pig cerebellum tissue,  pig spinal cord tissue\nPositive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, pig\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28301 Product name: Recombinant human CNTN2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 865-943 aa of NM_005076 Sequence: MRTAGLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESA Predict reactive species\nFull Name: contactin 2 (axonal)\nCalculated Molecular Weight: 113 kDa\nObserved Molecular Weight: 113-135 kDa\nGenBank Accession Number: NM_005076\nGene Symbol: CNTN2\nGene ID (NCBI): 6900\nRRID: AB_2918481\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q02246\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888110457001,"sku":"67089-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67089-1-ig","provider":"Iright","version":"1.0","type":"link"}