{"product_id":"proteintech-67092-2-ig","title":"Proteintech, 67092-2-Ig, ASAH1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ASAH1 (67092-2-Ig) by Proteintech is a Monoclonal antibody targeting ASAH1 in WB, IF\/ICC, ELISA applications with reactivity to human, rat, pig, rabbit samples\n67092-2-Ig targets ASAH1 in WB, IF\/ICC, ELISA applications and shows reactivity with human, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig liver tissue, pig brain tissue,  rabbit brain tissue,  rat brain tissue\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:20000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nASAH1, also named as AC, ACDase, Acid CDase, PHP32 and ASAH, belongs to the acid ceramidase family. ASAH1 is a lipid hydrolase that catalyzes the conversion of ceramide (cer) into sphingosine (SPH) and a free fatty acid. Mutation of ASAH1 will cause the Farber lipogranulomatosis (FL) which also known as Farber disease (FD). ASAH1 is highly expressed in Heart. And it is first synthesized as an 55-60 kDa precursor and subsequently processed to the mature, heterodimeric enzyme (40 + 13 kDa) in the endosomes\/lysosomes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat, pig, rabbit\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28645 Product name: Recombinant human ASAH1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-389 aa of BC016828 Sequence: MNCCIGLGEKARGSHRASYPSLSALFTEASILGFGSFAVKAQWTEDCRKSTYPPSGPTVFPAVIRYRGAVPWYTINLDLPPYKRWHELMLDKAPVPGLLGNFPGPFEEEMKGIAAVTDIPLGEIISFNIFYELFTVCTSIVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFSINGGYLGILEWILGKKDAMWIGFLTRTVLENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQFETYLRDCPDPCIGW Predict reactive species\nFull Name: N-acylsphingosine amidohydrolase (acid ceramidase) 1\nCalculated Molecular Weight: 44 kDa\nObserved Molecular Weight: 44-55 kDa\nGenBank Accession Number: BC016828\nGene Symbol: ASAH1\nGene ID (NCBI): 427\nRRID: AB_3085035\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q13510\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888100397225,"sku":"67092-2-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67092-2-ig","provider":"Iright","version":"1.0","type":"link"}