{"product_id":"proteintech-67094-1-ig","title":"Proteintech, 67094-1-Ig, RALB Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RALB (67094-1-Ig) by Proteintech is a Monoclonal antibody targeting RALB in WB, IHC, IF-P, ELISA applications with reactivity to Human, rat, pig, mouse samples\n67094-1-Ig targets RALB in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, rat, pig, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, rat brain tissue,  mouse brain tissue,  MCF-7 cells,  HepG2 cells,  Jurkat cells,  Pig brain cells\nPositive IHC detected in: mouse bladder tissue, human lung cancer tissue,  mouse liver tissue,  mouse lung tissue,  mouse placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human lung cancer tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:400-1:1600\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, rat, pig, mouse\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nAffinity: K D =1.82 x 10 -10 M K Off =2.54 x 10 -6 M K On =1.40 x 10 4 M\nImmunogen: CatNo: Ag28600 Product name: Recombinant human RALB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-206 aa of BC018163 Sequence: MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL Predict reactive species\nFull Name: v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein)\nCalculated Molecular Weight: 206 aa, 23 kDa\nObserved Molecular Weight: 24 kDa\nGenBank Accession Number: BC018163\nGene Symbol: RALB\nGene ID (NCBI): 5899\nRRID: AB_2882399\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P11234\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888048656553,"sku":"67094-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67094-1-ig","provider":"Iright","version":"1.0","type":"link"}