{"product_id":"proteintech-67131-1-ig","title":"Proteintech, 67131-1-Ig, FSH beta Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe FSH beta (67131-1-Ig) by Proteintech is a Monoclonal antibody targeting FSH beta in IHC, IF\/ICC, ELISA applications with reactivity to human samples\n67131-1-Ig targets FSH beta in IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human pituitary tissue, human pituitary adenoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe FSHB gene encodes the beta subunit of follicle-stimulating hormone (FSH), particularly expressed in gonadotroph cells within the anterior pituitary gland and plays a critical role in the regulation of gonadal function, pubertal maturation and reproductive processes in mammals. The transcription of the FSHB gene is critical for the production of the FSH hormone(PMID:28281143). And FSH is required for ovarian folliculogenesis in females, in males it promotes spermatogenesis in conjunction with testosterone(PMID:11739331). Mutations in FSHB gene would result in infertility both in men and women (PMID: 23766128).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag13788 Product name: Recombinant human FSHB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 19-129 aa of BC113488 Sequence: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE Predict reactive species\nFull Name: follicle stimulating hormone, beta polypeptide\nCalculated Molecular Weight: 129 aa, 15 kDa\nGenBank Accession Number: BC113488\nGene Symbol: FSHB\nGene ID (NCBI): 2488\nRRID: AB_2882430\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P01225\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888278032553,"sku":"67131-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67131-1-ig","provider":"Iright","version":"1.0","type":"link"}