{"product_id":"proteintech-67142-1-ig","title":"Proteintech, 67142-1-Ig, IRF8 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe IRF8 (67142-1-Ig) by Proteintech is a Monoclonal antibody targeting IRF8 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n67142-1-Ig targets IRF8 in WB, IF\/ICC, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Ramos cells, Raji cells,  Daudi cells\nPositive IF\/ICC detected in: THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIRF8 also named as ICSBP1, is a transcription factor of the IFN regulatory factor (IRF) family. The IRF family proteins bind to the IFN-stimulated response element (ISRE) and regulate expression of genes stimulated by type I IFNs, namely IFN-alpha and IFN-beta. IRF family proteins also control expression of IFN-alpha and IFN-beta-regulated genes that are induced by viral infection. IRF8 specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the IFN consensus sequence (ICS)). It plays a negative regulatory role in cells of the immune system. It is predominantly in lymphoid tissues.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag19909 Product name: Recombinant human IRF8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 121-426 aa of BC126247 Sequence: KLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGKLVGQATTTCPEGCRLSLSQPGLPGTKLYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLLHSSRQGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRLPDGRVVLCFGEEFPDMAPLRSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRENQQITV Predict reactive species\nFull Name: ICSBP1\nCalculated Molecular Weight: 426 aa, 48 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: BC126247\nGene Symbol: IRF8\nGene ID (NCBI): 3394\nRRID: AB_2882441\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q02556\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888066154665,"sku":"67142-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67142-1-ig","provider":"Iright","version":"1.0","type":"link"}