{"product_id":"proteintech-67149-1-ig","title":"Proteintech, 67149-1-Ig, TROVE2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TROVE2 (67149-1-Ig) by Proteintech is a Monoclonal antibody targeting TROVE2 in WB, IHC, ELISA applications with reactivity to Human, Mouse, Rat samples\n67149-1-Ig targets TROVE2 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  Jurkat cells,  HEK-293 cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTROVE2, also named as RO60 or RoRNP, is a 538 amino acid protein, which is localized in cytoplasmic mRNP granules containing untranslated mRNAs. TROVE2 as a RNA-binding protein that binds to misfolded non-coding RNAs, pre-5S rRNA, and several small cytoplasmic RNA molecules known as Y RNAs. TROVE2 may stabilize some of these RNAs and protect them from degradation (PubMed:18056422). TROVE2 binds to endogenous Alu retroelements which are induced by type I IFN and stimulate porinflammaotry cytokine secretion.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag4379 Product name: Recombinant human TROVE2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 21-369 aa of BC036658 Sequence: DGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKTFKTVEPTGK Predict reactive species\nFull Name: TROVE domain family, member 2\nCalculated Molecular Weight: 60 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC036658\nGene Symbol: TROVE2\nGene ID (NCBI): 6738\nRRID: AB_2882447\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P10155\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888333082793,"sku":"67149-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67149-1-ig","provider":"Iright","version":"1.0","type":"link"}