{"product_id":"proteintech-67182-1-ig","title":"Proteintech, 67182-1-Ig, AMPK Gamma 1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe AMPK Gamma 1 (67182-1-Ig) by Proteintech is a Monoclonal antibody targeting AMPK Gamma 1 in WB, ELISA applications with reactivity to Human, mouse, rat samples\n67182-1-Ig targets AMPK Gamma 1 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells,  PC-12 cells,  NIH\/3T3 cells,  RAW 264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:20000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProtein kinase, AMP-activated, gamma 1 non-catalytic subunit (PRKAG1, synonyms: AMPKG, MGC8666) is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an catalytic subunit, and non-catalytic and subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and iAMP-activated protein kinase (AMPK) is a highly conserved heterotrimeric serine\/threonine kinase widely characterised as a sensor of cellular energetic stress. AMPK is a heterotrimeric complex consisting of a catalytic α-subunit and two regulatory subunits (β and γ). AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. AMPK gamma 1 is one of the gamma regulatory subunits of AMPK.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28907 Product name: Recombinant human PRKAG1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 165-321 aa of BC000358 Sequence: LYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQA Predict reactive species\nFull Name: protein kinase, AMP-activated, gamma 1 non-catalytic subunit\nCalculated Molecular Weight: 38 kDa\nObserved Molecular Weight: 36-38 kDa\nGenBank Accession Number: BC000358\nGene Symbol: AMPK Gamma 1\nGene ID (NCBI): 5571\nRRID: AB_2882478\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P54619\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888053113001,"sku":"67182-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67182-1-ig","provider":"Iright","version":"1.0","type":"link"}