{"product_id":"proteintech-67200-1-ig","title":"Proteintech, 67200-1-Ig, SBDS Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SBDS (67200-1-Ig) by Proteintech is a Monoclonal antibody targeting SBDS in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n67200-1-Ig targets SBDS in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  HepG2 cells,  Jurkat cells,  HSC-T6 cells,  NIH\/3T3 cells,  4T1 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nShwachman-Bodian-Diamond syndrome (SBDS) is a member of a highly conserved protein family that exists from archaea to vertebrates and plants. The protein may function in RNA metabolism. Mutations within its gene are associated with Shwachman-Bodian-Diamond syndrome.This gene encodes a member of a highly conserved protein family that exists from archaea to vertebrates and plants. The encoded protein may function in RNA metabolism. Mutations within this gene are associated with Shwachman-Bodian-Diamond syndrome. An alternative transcript has been described, but its biological nature has not been determined.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag11731 Product name: Recombinant human SBDS protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-250 aa of BC065700 Sequence: MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE Predict reactive species\nFull Name: Shwachman-Bodian-Diamond syndrome\nCalculated Molecular Weight: 250 aa, 29 kDa\nObserved Molecular Weight: 29-31 kDa\nGenBank Accession Number: BC065700\nGene Symbol: SBDS\nGene ID (NCBI): 51119\nRRID: AB_2882493\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9Y3A5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888049377449,"sku":"67200-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67200-1-ig","provider":"Iright","version":"1.0","type":"link"}