{"product_id":"proteintech-67201-1-ig","title":"Proteintech, 67201-1-Ig, PITX2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PITX2 (67201-1-Ig) by Proteintech is a Monoclonal antibody targeting PITX2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n67201-1-Ig targets PITX2 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue, HEK-293 cells,  mouse brain tissue,  rat cerebellum tissue,  mouse cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPITX2 belongs to the bicoid class of homeodomain transcription factors, which play essential roles in embryonic development. Various PITX2 isoforms are involved in a wide variety of developmental programs, including left-right signaling. It controls cell proliferation in a tissue-specific manner and is involved in morphogenesis. During embryonic development, PITX2 is involved in the expansion of muscle progenitors. In addition, it may play a role in the proper localization of asymmetric organs such as the heart and stomach. PITX2 can be bound by some other proteins, and are part of a much larger atrial transcriptional complex. This antibody specifically recognizes isoform PTX2C.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag27924 Product name: Recombinant human PITX2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-286 aa of BC013998 Sequence: MNCMKGPLHLEHRAAGTKLSAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRLEVHTISDTSSPEAAEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNS Predict reactive species\nFull Name: paired-like homeodomain 2\nCalculated Molecular Weight: 36 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC013998\nGene Symbol: PITX2\nGene ID (NCBI): 5308\nRRID: AB_2882494\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q99697\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888031977641,"sku":"67201-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-67201-1-ig","provider":"Iright","version":"1.0","type":"link"}